University at Buffalo - The State University of New York
Skip to Content
The Clinical Proteomic Technologies for Cancer | Details for Gelsolin

Gelsolin


Background

Catalog Number:

CPTC-Gelsolin-1

Target Antigen:

Gelsolin

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

12/15/2011

Antigen Recognition(s):

recombinant full-length

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-Gelsolin-1 as primary Ab against Ag 10594 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Gelsolin-1 Western Blot

Western Blot using CPTC-Gelsolin-1 as primary Ab against Ag 10594 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-Gelsolin-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-Gelsolin-1 CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-Gelsolin-1 Protein Array

Protein Array in which CPTC-Gelsolin-1 CPTC-AKR1B1-1 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

Background

Catalog Number:

CPTC-Gelsolin-2

Target Antigen:

Gelsolin

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

03/13/2014

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-Gelsolin-2 as primary Ab against Gelsolin (rAg 10594) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Gelsolin-2 Western blot

Western Blot using CPTC-Gelsolin-2 as primary Ab against Gelsolin (rAg 10594) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-Gelsolin-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag Gelsolin (NCI 10594) in (lane 2). Click image to enlarge

CPTC-Gelsolin-2 Cell Lysate Western blot

Western Blot using CPTC-Gelsolin-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag Gelsolin (NCI 10594) in (lane 2).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-Gelsolin-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array

CPTC-Gelsolin-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-Gelsolin-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-Gelsolin-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  SPR
Download Gelsolin pairing.pdf (769.0 KB)

SPR pairing results

This table summarizes the results of the pairing experiment with Gelsolin antibodies.

  SPR
Click to enlarge image Kinetic titration data for Gelsolin-2 using Biacore SPR method Click image to enlarge

CPTC-Gelsolin-2 SPR

Kinetic titration data for Gelsolin-2 using Biacore SPR method

Background

Catalog Number:

CPTC-Gelsolin-3

Target Antigen:

Gelsolin

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

03/13/2014

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-Gelsolin-3 as primary Ab against Gelsolin (rAg 10594) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Gelsolin-3 Western blot

Western Blot using CPTC-Gelsolin-3 as primary Ab against Gelsolin (rAg 10594) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-Gelsolin-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag Gelsolin (NCI 10594) in (lane 2). Click image to enlarge

CPTC-Gelsolin-3 Cell Lysate Western blot

Western Blot using CPTC-Gelsolin-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag Gelsolin (NCI 10594) in (lane 2).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-Gelsolin-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array

CPTC-Gelsolin-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-Gelsolin-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC NCI60

CPTC-Gelsolin-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  SPR
Download Gelsolin pairing.pdf (769.0 KB)

SPR pairing results

This table summarizes the results of the pairing experiment with Gelsolin antibodies.

  SPR
Click to enlarge image Kinetic titration data for Gelsolin-3 antibody using Biacore SPR method Click image to enlarge

CPTC-Gelsolin-3 SPR

Kinetic titration data for Gelsolin-3 antibody using Biacore SPR method

Background

Catalog Number:

CPTC-Gelsolin-4

Target Antigen:

Gelsolin

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

03/13/2014

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-Gelsolin-4 as primary Ab against Gelsolin (rAg 10594) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-Gelsolin-4 Western blot

Western Blot using CPTC-Gelsolin-4 as primary Ab against Gelsolin (rAg 10594) in lane 2. Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-Gelsolin-4 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag Gelsolin (NCI 10594) in (lane 2). Click image to enlarge

CPTC-Gelsolin-4 Cell Lysate Western blot

Western Blot using CPTC-Gelsolin-4 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag Gelsolin (NCI 10594) in (lane 2).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding. Click image to enlarge

CPTC-Gelsolin-4 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate). Note: B50% represents the concentration of Ab required to generate 50% of maximum binding.

  NCI 60 Protein Array

CPTC-Gelsolin-4 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-Gelsolin-4 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-Gelsolin-4 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  SPR
Download Gelsolin pairing.pdf (769.0 KB)

SPR pairing results

This table summarizes the results of the pairing experiment with Gelsolin antibodies.

  SPR
Click to enlarge image Kinetic titration data for Gelsolin-4 antibody using Biacore SPR method Click image to enlarge

CPTC Gelsolin-4 SPR

Kinetic titration data for Gelsolin-4 antibody using Biacore SPR method

Background

NCI Identification Number:

10594

Antigen Name:

Gelsolin

CPTC Name:

CPTC-Gelsolin

Keywords:

amyloidosis, Finnish type; GSN; ADF; AGEL; Brevin; DKFZp313L0718; OTTHUMP00000022011; OTTHUMP00000162202

Function:

The protein encoded by this gene binds to the "plus" ends of actin monomers and filaments
to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene.

Chromosomal Localization:

9q33

Expression System:

E. Coli

NCBI Accession Number:

BC026033

Swiss Prot Accession Number:

P06396

DNA Source:

HIP:HsCD00005767

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

115405

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAATASRGASQAGAPQGRVPEARPNSMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKT
VQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF
KHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNER
SGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKS
EDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDG
LGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNY
RHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGG
QTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQV
AEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVF
VWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA

Native Sequence:

MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPNSMVVEHPEFLKAGKEPGLQIWRVEKFDLV
PVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFL
GYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYER
LKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVA
DENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKN
WRDPDQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSY
IILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSR
EGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQV
AEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWV
GKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA

Calculated Isoelectric Point:

5.71

Molecular Weight:

83231

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Kinetic titration data for Gelsolin-4 antibody using Biacore SPR method
Click image to enlarge

Ag 10594 PAGE

PAGE of Ag 10594 with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com