University at Buffalo - The State University of New York
Skip to Content
The Clinical Proteomic Technologies for Cancer | Details for 26S proteasome non-ATPase regulatory subunit 4

26S proteasome non-ATPase regulatory subunit 4


Background

Catalog Number:

CPTC-PSMD4-1

Target Antigen:

26S proteasome non-ATPase regulatory subunit 4

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

02/28/2013

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-PSMD4-1 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-PSMD4-1 Western blot

Western Blot using CPTC-PSMD4-1 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-PSMD4-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4). Click image to enlarge

CPTC-PSMD4-1 Cell Lysate Western blot

Western Blot using CPTC-PSMD4-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PSMD4-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array

CPTC-PSMD4-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-PSMD4-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-PSMD4-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC HPA
Download CPTC-PSMD4-1.pdf (91.2 KB)

CPTC-PSMD4-1 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

Catalog Number:

CPTC-PSMD4-2

Target Antigen:

26S proteasome non-ATPase regulatory subunit 4

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

01/24/2013

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-PSMD4-2 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-PSMD4-2 Western blot

Western Blot using CPTC-PSMD4-2 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-PSMD4-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4). Click image to enlarge

CPTC-PSMD4-2 Cell Lysate Western blot

Western Blot using CPTC-PSMD4-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PSMD4-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-PSMD4-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-PSMD4-2 Protein Array

Protein Array in which CPTC-PSMD4-2 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC HPA
Download CPTC-PSMD4-2.pdf (86.2 KB)

CPTC-PSMD4-2 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

Catalog Number:

CPTC-PSMD4-3

Target Antigen:

26S proteasome non-ATPase regulatory subunit 4

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

11/26/2013

Antigen Recognition(s):

Purchase
External Links
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-PSMD4-3 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3). Click image to enlarge

CPTC-PSMD4-3 Western blot

Western Blot using CPTC-PSMD4-3 as primary Ab against rAg 11015 (PSMD4) (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG as control for goat anti-mouse HRP secondary binding (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-PSMD4-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4). Click image to enlarge

CPTC-PSMD4-3 Cell Lysate Western blot

Western Blot using CPTC-PSMD4-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 2). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 3) and recombinant Ag PSMD4 (NCI 11015) in (lane 4).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-PSMD4-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array
Click to enlarge image Protein Array in which CPTC-PSMD4-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red). Click image to enlarge

CPTC-PSMD4-3 Protein Array

Protein Array in which CPTC-PSMD4-3 is screened against the NCI60 cell line panel for expression. Data is normalized to a mean signal of 1.0 and standard deviation of 0.5. Color conveys over-expression level (green), basal level (blue), under-expression level (red).

  IHC Tissue
Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer  showing cytoplasmic staining using Antibody CPTC-PSMD4-3. Titer: 1:500 Click image to enlarge

CPTC-PSMD4-3 IHC Tissue

Tissue Micro-Array(TMA) core of colon cancer showing cytoplasmic staining using Antibody CPTC-PSMD4-3. Titer: 1:500

  IHC HPA
Download CPTC-PSMD4-3.pdf (103.7 KB)

CPTC-PSMD4-3 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

NCI Identification Number:

11015

Antigen Name:

26S proteasome non-ATPase regulatory subunit 4

CPTC Name:

CPTC-PSMD4

Keywords:

AF; AF-1; ASF; MCB1; OTTHUMP00000014286; OTTHUMP00000059963; Rpn10; S5A; angiocidin; pUB-R5

Function:

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the non-ATPase subunits of the 19S regulator lid. Pseudogenes have been identified on chromosomes 10 and 21.

Binds and presumably selects ubiquitin-conjugates for destruction. Displays selectivity for longer polyubiquitin chains. Modulates intestinal fluid secretion.

Chromosomal Localization:

1q21.2

Expression System:

E. Coli

NCBI Accession Number:

BC072008.1

Swiss Prot Accession Number:

P55036

DNA Source:

OB : MHS1011-98054211

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

4595

Buffers:

PBS

Expressed Sequence:

SNAMVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVL
TTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLV
KLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPIL
AGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGT
EDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTS
EPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQATKDGKKDKKEEDKK

Native Sequence:

MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTT
LTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVK
LAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPIL
AGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTG
TEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMD
TSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQATKDGKKDKKEEDKK

Calculated Isoelectric Point:

4.68

Molecular Weight:

40.74

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Tissue Micro-Array(TMA) core of colon cancer  showing cytoplasmic staining using Antibody CPTC-PSMD4-3. Titer: 1:500
Click image to enlarge

CPTC-PSMD4 SDS-PAGE

PAGE of PSMD4 (Ag 11015) with molecular weight standards in lane 1

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com