University at Buffalo - The State University of New York
Skip to Content
The Clinical Proteomic Technologies for Cancer | Details for Squamous cell carcinoma antigen 1

Squamous cell carcinoma antigen 1


Background

Catalog Number:

CPTC-SERPINB3-1

Target Antigen:

Squamous cell carcinoma antigen 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/25/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-SERPINB3-1 as primary Ab against Ag 10350 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-SERPINB3-1 Western Blot

Western Blot using CPTC-SERPINB3-1 as primary Ab against Ag 10350 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-SERPINB3-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag SERPINB3 (NCI 10350) in (lane 2). Click image to enlarge

CPTC-SERPINB3-1 Cell Lysate blot

Western Blot using CPTC-SERPINB3-1 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag SERPINB3 (NCI 10350) in (lane 2).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-SERPINB3-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array

CPTC-SERPINB3-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-SERPINB3-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-SERPINB3-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-SERPINB3-2

Target Antigen:

Squamous cell carcinoma antigen 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/25/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-SERPINB3-2 as primary Ab against Ag 10350 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-SERPINB3-2 Western Blot

Western Blot using CPTC-SERPINB3-2 as primary Ab against Ag 10350 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-SERPINB3-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag SERPINB3 (NCI 10350) in (lane 2). Click image to enlarge

CPTC-SERPINB3-2 Cell Lysate blot

Western Blot using CPTC-SERPINB3-2 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag SERPINB3 (NCI 10350) in (lane 2).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-SERPINB3-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array

CPTC-SERPINB3-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-SERPINB3-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-SERPINB3-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

Catalog Number:

CPTC-SERPINB3-3

Target Antigen:

Squamous cell carcinoma antigen 1

Isotype:

IgG1

Species:

Mouse Monoclonal Antibody

Last Updated:

02/25/2013

Antigen Recognition(s):

recombinant full-length

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-SERPINB3-3 as primary Ab against Ag 10350 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-SERPINB3-3 Western Blot

Western Blot using CPTC-SERPINB3-3 as primary Ab against Ag 10350 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Cell Lysate Western Blot
Click to enlarge image Western Blot using CPTC-SERPINB3-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag SERPINB3 (NCI 10350) in (lane 2). Click image to enlarge

CPTC-SERPINB3-3 Cell Lysate blot

Western Blot using CPTC-SERPINB3-3 as primary Ab against cell lysate from transiently overexpressed HEK293T cells form Origene (lane 3). Also included are molecular wt. standards (lane 1), lysate from non-transfected HEK293T cells as neg control (lane 4) and recombinant Ag SERPINB3 (NCI 10350) in (lane 2).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-SERPINB3-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array

CPTC-SERPINB3-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-SERPINB3-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-SERPINB3-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Background

NCI Identification Number:

10350

Antigen Name:

Squamous cell carcinoma antigen 1

CPTC Name:

CPTC-SERPINB3

Keywords:

SERPINB3; HsT1196; SCC; SCCA; SCCA-1; SCCA-PD; SCCA1; T4-A

Function:

May act as a protease inhibitor to modulate the host immune response against tumor cells

Chromosomal Localization:

18q21.3

Expression System:

E. Coli

NCBI Accession Number:

BC005224

Swiss Prot Accession Number:

P29508

DNA Source:

HIP:HsCD00004245

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

39880

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVT
ENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQT
SVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDT
KEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKL
TAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSG
VLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP

Native Sequence:

MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTEN
TTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTS
VESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDT
KEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEK
LTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVL
SGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP

Calculated Isoelectric Point:

6.34

Molecular Weight:

44837

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click image to enlarge

Ag 10350

PAGE of Ag 10350 with molecular weight standards (lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com