University at Buffalo - The State University of New York
Skip to Content
The Clinical Proteomic Technologies for Cancer | Details for DNA-damage inducible transcript 3

DNA-damage inducible transcript 3


Background

Catalog Number:

CPTC-DDIT3-1

Target Antigen:

DNA-damage inducible transcript 3

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

02/26/2013

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-DDIT3-1 as primary Ab against Ag 10299 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-DDIT3-1 Western blot

Western Blot using CPTC-DDIT3-1 as primary Ab against Ag 10299 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-DDIT3-1 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array

CPTC-DDIT3-1 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-DDIT3-1 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-DDIT3-1 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC HPA
Download CPTC-DDIT3-1.pdf (95.8 KB)

CPTC-DDIT3-1 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

Catalog Number:

CPTC-DDIT3-2

Target Antigen:

DNA-damage inducible transcript 3

Isotype:

IgG2b

Species:

Mouse Monoclonal Antibody

Last Updated:

02/26/2013

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-DDIT3-2 as primary Ab against Ag 10299 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-DDIT3-2 Western blot

Western Blot using CPTC-DDIT3-2 as primary Ab against Ag 10299 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-DDIT3-2 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array

CPTC-DDIT3-2 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-DDIT3-2 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-DDIT3-2 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC HPA
Download CPTC-DDIT3-2.pdf (96.3 KB)

CPTC-DDIT3-2 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

Catalog Number:

CPTC-DDIT3-3

Target Antigen:

DNA-damage inducible transcript 3

Isotype:

IgG2a

Species:

Mouse Monoclonal Antibody

Last Updated:

02/26/2013

Antigen Recognition(s):

Purchase
Characterization Data [Compare Characterization Data]
  Western Blot
Click to enlarge image Western Blot using CPTC-DDIT3-3 as primary Ab against Ag 10299 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-DDIT3-3 Western blot

Western Blot using CPTC-DDIT3-3 as primary Ab against Ag 10299 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).

  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-DDIT3-3 Indirect ELISA

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)

  NCI 60 Protein Array

CPTC-DDIT3-3 NCI 60 Protein Array

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.

  IHC NCI60

CPTC-DDIT3-3 IHC NCI60

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

Click to view IHC NCI60 Cell Line Array example
Close

IHC Cell Line Images

IHC NCI60 Cell Line Array example
  IHC Tissue

CPTC-DDIT3-3 IHC Tissue

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.

  IHC HPA
Download CPTC-DDIT3-3.pdf (102.2 KB)

CPTC-DDIT3-3 Evaluation by the Human Protein Atlas

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)

Background

NCI Identification Number:

10299

Antigen Name:

DNA-damage inducible transcript 3

CPTC Name:

CPTC-DDIT3

Keywords:

DNA-damage-inducible transcript 3; CHOP10; GADD153; CHOP; C/EBP-homologous protein 10; Growth arrest and DNA damage-inducible protein GADD 153; DDIT-3

Function:

This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP(liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and
erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified.

Chromosomal Localization:

12q13.1 - q13.2

Expression System:

E. Coli

NCBI Accession Number:

BC003637.1

Swiss Prot Accession Number:

P35638

DNA Source:

DNASU - HsCD00003368

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

19480

Buffers:

PBS without Ca++ and Mg++

Expressed Sequence:

SNAMAAESLPFSFGTLSSWELEAWYEDLQEVLSSD
ENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEE
PEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRT
RKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEE
NERLKQEIERLTREVEATRRALIDRMVNLHQA

Native Sequence:

MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDEN
GGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEP
EPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRT
RKRKQSGHSPARAGKQRMKEKEQENERKVAQLAE
ENERLKQEIERLTREVEATRRALIDRMVNLHQA

Calculated Isoelectric Point:

4.61

Molecular Weight:

19447

Last Updated:

11/14/2012

Links

Characterization Data

Gel

Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate)
Click image to enlarge

CPTC-DDIT3 PAGE

PAGE of Ag 10299 (with molecular weight standards in lane 1)

SOPs

Don't have Adobe Reader™?

Get it for free at Adobe.com